An example of the alignment with CLUSTAL format: 

CLUSTAL W(1.60) multiple sequence alignment



YPK1            SQLSWKRLLMKGYIPPYKPAVS-----NSMDTSNFDEEFTR---EKPIDSVVDEYLSESV
YPK2            KDISWKKLLLKGYIPPYKPIVK-----SEIDTANFDQEFTK---EKPIDSVVDEYLSASI
KPCA_HUMAN      RRIDWEKLENREIQPPFKPKVC------GKGAENFDKFFTR---GQPVLTPPDQLVIANI
KPCZ_HUMAN      RSIDWDLLEKKQALPPFQPQIT-----DDYGLDNFDTQFTS---EPVQLTPDDEDAIKRI
KAPA            KEVVWEKLLSRNIETPYEPPIQ----QGQGDTSQFDKYPE----EDINYGVQGEDPYADL
KAPC            NEVIWEKLLARYIETPYEPPIQ----QGQGDTSQFDRYPE----EEFNYGIQGEDPYMDL
KAPB            SEVVWERLLAKDIETPYEPPIT----SGIGDTSLFDQYPE----EQLDYGIQGDDPYAEY
KS6_HUMAN       RHINWEELLARKVEPPFKPLLQ-----SEEDVSQFDSKFTR---QTPVDSP-DDSTLSES
KPC1            RNINFDDILNLRVKPPYIPEIK-----SPEDTSYFEQEFTS---APPTLTPLPSVLTTSQ
KRAC_BOVIN      ASIVWQDVYEKKLSPPFKPQVT-----SETDTRYFDEEFTA---QMITITPPDQDDSMEG
SCH9            ADIDWEALKQKKIPPPFKPHLV-----SETDTSNFDPEFTT---ASTSYMNKHQPMMTAT
KGP1_DROME      LGFDWDGLASQLLIPPFVRPIA-----HPTDVRYFDRFPC------DLNEPPDELSGWDA
ARK2_RAT        KGIDWQYVYLRKYPPPLIPPRGEVNAADAFDIGSFDEEDTKG--IKLLDCDQDLYKNFPL
DBFB            AEINFETLRTS--SPPFIPQLD-----DETDAGYFDDFTNEEDMAKYADVFKRQNKLSAM
DBF2            ADINFSTLRSM--IPPFTPQLD-----SETDAGYFDDFTSEADMAKYADVFKRQDKLTAM
                               *                  *.                        

YPK1            ------QKQF
YPK2            ------QKQF
KPCA_HUMAN      D-----QSDF
KPCZ_HUMAN      D-----QSEF
KAPA            ------FRDF
KAPC            ------MKEF
KAPB            ------FQDF
KS6_HUMAN       A-----NQVF
KPC1            ------QEEF
KRAC_BOVIN      VDS-ERRPHF
SCH9            PLSPAMQAKF
KGP1_DROME      --------DF
ARK2_RAT        MISERWQQEV
DBFB            VDDSAVDSKL
DBF2            VDDSAVSSKL