An example of the alignment with Fasta format: 

>YPK1
SQLSWKRLLMKGYIPPYKPAVS-----NSMDTSNFDEEFTR---EKPIDSVVDEYLSESV
------QKQF
>YPK2
KDISWKKLLLKGYIPPYKPIVK-----SEIDTANFDQEFTK---EKPIDSVVDEYLSASI
------QKQF
>KPCA_HUMAN
RRIDWEKLENREIQPPFKPKVC------GKGAENFDKFFTR---GQPVLTPPDQLVIANI
D-----QSDF
>KPCZ_HUMAN
RSIDWDLLEKKQALPPFQPQIT-----DDYGLDNFDTQFTS---EPVQLTPDDEDAIKRI
D-----QSEF
>KAPA
KEVVWEKLLSRNIETPYEPPIQ----QGQGDTSQFDKYPE----EDINYGVQGEDPYADL
------FRDF
>KAPC
NEVIWEKLLARYIETPYEPPIQ----QGQGDTSQFDRYPE----EEFNYGIQGEDPYMDL
------MKEF
>KAPB
SEVVWERLLAKDIETPYEPPIT----SGIGDTSLFDQYPE----EQLDYGIQGDDPYAEY
------FQDF
>KS6_HUMAN
RHINWEELLARKVEPPFKPLLQ-----SEEDVSQFDSKFTR---QTPVDSP-DDSTLSES
A-----NQVF
>KPC1
RNINFDDILNLRVKPPYIPEIK-----SPEDTSYFEQEFTS---APPTLTPLPSVLTTSQ
------QEEF
>KRAC_BOVIN
ASIVWQDVYEKKLSPPFKPQVT-----SETDTRYFDEEFTA---QMITITPPDQDDSMEG
VDS-ERRPHF
>SCH9
ADIDWEALKQKKIPPPFKPHLV-----SETDTSNFDPEFTT---ASTSYMNKHQPMMTAT
PLSPAMQAKF
>KGP1_DROME
LGFDWDGLASQLLIPPFVRPIA-----HPTDVRYFDRFPC------DLNEPPDELSGWDA
--------DF
>ARK2_RAT
KGIDWQYVYLRKYPPPLIPPRGEVNAADAFDIGSFDEEDTKG--IKLLDCDQDLYKNFPL
MISERWQQEV
>DBFB
AEINFETLRTS--SPPFIPQLD-----DETDAGYFDDFTNEEDMAKYADVFKRQNKLSAM
VDDSAVDSKL
>DBF2
ADINFSTLRSM--IPPFTPQLD-----SETDAGYFDDFTSEADMAKYADVFKRQDKLTAM
VDDSAVSSKL